PPIRE04398
Target Protein Information
| Protein_Name | Peptide deformylase |
|---|---|
| Protein_Sequence | MSVLQVLHIPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEEGIGLAATQVDIHQRIIVIDVSENRDERLVLINPELLEKSGETGIEEGCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADGLLAICIQHEMDHLVGKLFMDYLSPLKQQRIRQKVEKLDRLKARA |
| Organism_Source | Escherichia coli (strain SE11) |
| Functional_Classification | metalloproteases |
| Cellular_Localization | Cytoplasm |
| Gene_Names | def |
| UniProt_ID | B6I200 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Met-Ala-Ser |
|---|---|
| Peptide_Sequence | MAS |
| Peptide_Length | 3 |
| Peptide_SMILES | CSCC[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@@H](CO)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 307.36 |
|---|---|
| Aliphatic_Index | 33.33333 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 3.00000 |
| Charge_at_pH_7 | -0.00202 |
| Isoelectric_Point | 6.10000 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 6 |
| Number_of_Hydrogen_Bond_Donors | 5 |
| Topological_Polar_Surface_Area | 141.75000 |
| X_logP_energy | -1.86680 |
Interaction Information
| Affinity | Ki=53000 uM |
|---|---|
| Affinity_Assay | Enzyme Inhibition Kinetics |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Design and synthesis of substrate analogue inhibitors of peptide deformylase. |
| Release_Year | 1999 |
| PMID | 10194346 |
| DOI | 10.1021/bi982622r |