PPIRE04727
Target Protein Information
| Protein_Name | Chymase |
|---|---|
| Protein_Sequence | MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN |
| Organism_Source | Homo sapiens |
| Functional_Classification | serine peptidase |
| Cellular_Localization | Extracellular |
| Gene_Names | CMA1 |
| UniProt_ID | P23946 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | MeOsuc-AAPF-(OPh)2 |
|---|---|
| Peptide_Sequence | AAPF |
| Peptide_Length | 4 |
| Peptide_SMILES | C[C@H](N)C(=O)N[C@@H](C)C(=O)N1CCC[C@H]1C(=O)N[C@@H](Cc1ccccc1)C(=O)O |
| Chemical_Modification | |
| Cyclization_Method | |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Succinyl |
| C-terminal_Modification | di-phenyl phosphonate |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 404.47 |
|---|---|
| Aliphatic_Index | 50.00000 |
| Aromaticity | 0.25000 |
| Average_Rotatable_Bonds | 2.00000 |
| Charge_at_pH_7 | -0.00202 |
| Isoelectric_Point | 6.10000 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 5 |
| Number_of_Hydrogen_Bond_Donors | 4 |
| Topological_Polar_Surface_Area | 141.83000 |
| X_logP_energy | -0.35860 |
Interaction Information
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Albumin is a substrate of human chymase. Prediction by combinatorial peptide screening and development of a selective inhibitor based on the albumin cleavage site. |
| Release_Year | 2003 |
| PMID | 12815038 |
| DOI | 10.1074/jbc.M304087200 |