PPIRE04779
Target Protein Information
| Protein_Name | Caspase-3 |
|---|---|
| Protein_Sequence | MDNNETSVDSKSINNFETKTIHGSKSMDSGIYLDSSYKMDYPEMGLCIIINNKNFHKSTGMSARNGTDVDAANLRETFMALKYEVRNKNDLTREEIMELMDSVSKEDHSKRSSFVCVILSHGDEGVIFGTNGPVDLKKLTSFFRGDYCRSLTGKPKLFIIQACRGTELDCGIETDSGTDDDMACQKIPVEADFLYAYSTAPGYYSWRNSRDGSWFIQSLCAMLKLYAHKLEFMHILTRVNRKVATEFESFSLDATFHAKKQIPCIVSMLTKELYFYH |
| Organism_Source | Rattus norvegicus |
| Functional_Classification | caspases |
| Cellular_Localization | Cytoplasm |
| Gene_Names | Casp3 |
| UniProt_ID | P55213 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | z-DEVD-fmk |
|---|---|
| Peptide_Sequence | DEVD |
| Peptide_Length | 4 |
| Peptide_SMILES | CC(C)[C@H](NC(=O)[C@H](CCC(=O)O)NC(=O)[C@@H](N)CC(=O)O)C(=O)N[C@@H](CC(=O)O)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Benzyloxycarbonyl |
| C-terminal_Modification | fluoromethylketone |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 476.44 |
|---|---|
| Aliphatic_Index | 72.50000 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 3.75000 |
| Charge_at_pH_7 | -2.99935 |
| Isoelectric_Point | 3.38003 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 8 |
| Number_of_Hydrogen_Bond_Donors | 8 |
| Topological_Polar_Surface_Area | 262.52000 |
| X_logP_energy | -2.67710 |
Interaction Information
| Affinity | IC50=18 uM |
|---|---|
| Affinity_Assay | ELISA |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | A novel peptide inhibitor targeted to caspase-3 cleavage site of a proapoptotic kinase protein kinase C delta (PKCdelta)protects against dopaminergic neuronal degeneration in Parkinson's disease models. |
| Release_Year | 2006 |
| PMID | 17045926 |
| DOI | 10.1016/j.freeradbiomed.2006.08.016 |