PPIRE04981
Target Protein Information
| Protein_Name | 5-hydroxytryptamine receptor 1D |
|---|---|
| Protein_Sequence | MSLPNQSAEGLLQGAPNRSLNATATQGAWDPGTLQALKIALVVLLSIITLATVLSNAFVLTTIFLTRKLHTPANCLIGSLAMTDLLVSILVMPISIAYTTTHTWSFGQLLCDIWLSSDITCCTASILHLCVIALDRYWAITDALEYSKRRTVGHAAAMITVVWAISVCISIPPLFWRQAKTHEEMSDCLVNTSQISYTIYSTCGAFYIPSVLLIILYGRIYMAARNRILNPPSLYGKRFTTAHLITGSAGSSLCSLNPSLHEGHSHSAGSPLFFNHVKIKLADSVLERKRISAARERKATKTLGIILGAFIVCWLPFFVASLVLPICRDSCWIHPALFDFFTWLGYLNSLINPIIYTMFNEEFRQAFQKVVRFRKTS |
| Organism_Source | Bos taurus |
| Functional_Classification | G protein-coupled receptor |
| Cellular_Localization | Plasma membrane |
| Gene_Names | HTR1D |
| UniProt_ID | F1MMU1 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | LSAL |
|---|---|
| Peptide_Sequence | LSAL |
| Peptide_Length | 4 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CC(C)C)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 402.49 |
|---|---|
| Aliphatic_Index | 220.00000 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 3.00000 |
| Charge_at_pH_7 | -0.00202 |
| Isoelectric_Point | 6.10000 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 6 |
| Number_of_Hydrogen_Bond_Donors | 6 |
| Topological_Polar_Surface_Area | 170.85000 |
| X_logP_energy | -1.04290 |
Interaction Information
| Affinity | IC50=71 pM |
|---|---|
| Affinity_Assay | radioligand binding assay |
| PDB_ID | None |
| Type | Allosteric modulator |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Isolation and characterization of an endogenous peptide from rat brain interacting specifically with the serotonergic 1B receptor subtypes. |
| Release_Year | 1996 |
| PMID | 8557679 |
| DOI | 10.1074/jbc.271.2.726 |