PPIRE05501
Target Protein Information
| Protein_Name | Superoxide dismutase [Cu-Zn] |
|---|---|
| Protein_Sequence | MATKAVCVLKGDGPVQGTIHFEAKGDTVVVTGSITGLTEGDHGFHVHQFGDNTQGCTSAGPHFNPLSKKHGGPKDEERHVGDLGNVTADKNGVAIVDIVDPLISLSGEYSIIGRTMVVHEKPDDLGRGGNEESTKTGNAGSRLACGVIGIAK |
| Organism_Source | Bos taurus |
| Functional_Classification | oxidoreductases |
| Cellular_Localization | Cytoplasm |
| Gene_Names | SOD1 |
| UniProt_ID | P00442 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Abeta29-33 |
|---|---|
| Peptide_Sequence | GAIIG |
| Peptide_Length | 5 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](C)NC(=O)CN)C(=O)N[C@H](C(=O)NCC(=O)O)[C@@H](C)CC |
| Chemical_Modification | |
| Cyclization_Method | |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 429.52 |
|---|---|
| Aliphatic_Index | 176.00000 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 2.60000 |
| Charge_at_pH_7 | -0.00202 |
| Isoelectric_Point | 6.10000 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 6 |
| Number_of_Hydrogen_Bond_Donors | 6 |
| Topological_Polar_Surface_Area | 179.72000 |
| X_logP_energy | -1.28760 |
Interaction Information
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Interaction of superoxide dismutase with the glycine zipper regions of Beta-amyloid peptides: is there an implication towards Alzheimer's disease and oxidative stress? |
| Release_Year | 2013 |
| PMID | 22524677 |
| DOI | 10.3109/14756366.2012.680063 |