PPIRE05574
Target Protein Information
| Protein_Name | Gag polyprotein |
|---|---|
| Protein_Sequence | MGASASVLTGSKLDAWEQIRLKPGSKKKYRLKHLVWASRELERFACNPELLETAEGNEKLLQQLEPALKTGSDSLQSLWNAIVVLWCVHNRYKIGDTQQAIQKLKEVMGSRKSADAAKEDTSARQAGQNYPIVSNAQGQMVHQAISPRTLNAWVKAVEEKAFNPEIIPMFMALSEGAISYDINTMLNAIGGHQGALQVLKEVINEEAVEWDRTHPPPVGPLPPGQIREPTGSDIAGTTSTQQEQIHWTTRPNQPIPVGDIYRKWIVLGLNKMVKMYSPVSILDIKQGPKEPFRDYVDRFYKTLRAEQATQEVKNWMTETLLVQNANPDCKQILKSLGPGATLEEMMVACQGVGGPTHKARVLAEAMATAQQDLKGGYTAVFMQRGQNPIRKGTIKCFNCGKEGHIARNCRAPRKKGCWKCGQEGHQMKDCRNGKQANFLGKYWPPGGTRPGNYVQRPAHPSAPPMEEEVKGQENQEQKGGPNELYPFASLKSLFGTDQ |
| Organism_Source | Human immunodeficiency virus type 1 group O (isolate ANT70) |
| Functional_Classification | matrix protein |
| Cellular_Localization | Cytoplasm |
| Gene_Names | gag |
| UniProt_ID | Q77372 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | HIV-1 MA NLS |
|---|---|
| Peptide_Sequence | KKQYK |
| Peptide_Length | 5 |
| Peptide_SMILES | NCCCC[C@H](NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](N)CCCCN)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 693.84 |
|---|---|
| Aliphatic_Index | 0.00000 |
| Aromaticity | 0.20000 |
| Average_Rotatable_Bonds | 5.20000 |
| Charge_at_pH_7 | 2.99625 |
| Isoelectric_Point | 10.64292 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 11 |
| Number_of_Hydrogen_Bond_Donors | 11 |
| Topological_Polar_Surface_Area | 321.10000 |
| X_logP_energy | -2.06170 |
Interaction Information
| Affinity | IC50=12 uM |
|---|---|
| Affinity_Assay | ELISA |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Backbone cyclic peptide, which mimics the nuclear localization signal of human immunodeficiency virus type 1 matrix protein, inhibits nuclear import and virus production in nondividing cells. |
| Release_Year | 1998 |
| PMID | 9548947 |
| DOI | 10.1021/bi972878h |