PPIRE06226
Target Protein Information
| Protein_Name | Gag-Pol polyprotein |
|---|---|
| Protein_Sequence | IPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIIDIIATDIQTKELQKQITKIQNFRVYYRDSRDPIWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKVKIIRDYGKQMAGDDCVASRQDED |
| Organism_Source | Human immunodeficiency virus type 1 group M subtype D (isolate Z6) |
| Functional_Classification | integrases |
| Cellular_Localization | Nucleus |
| Gene_Names | gag-pol |
| UniProt_ID | P04586 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | synthetic DLTHAQ |
|---|---|
| Peptide_Sequence | DLTHAQ |
| Peptide_Length | 6 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)[C@@H](N)CC(=O)O)C(=O)N[C@H](C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(N)=O)C(=O)O)[C@@H](C)O |
| Chemical_Modification | |
| Cyclization_Method | |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 683.72 |
|---|---|
| Aliphatic_Index | 81.66667 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 3.50000 |
| Charge_at_pH_7 | -0.91066 |
| Isoelectric_Point | 5.29226 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 11 |
| Number_of_Hydrogen_Bond_Donors | 11 |
| Topological_Polar_Surface_Area | 338.12000 |
| X_logP_energy | -4.02490 |
Interaction Information
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | [Isolation and structure of novel peptide inhibitor of HIV-1 integrase from marine polychaetes]. |
| Release_Year | 2011 |
| PMID | 21721256 |
| DOI | 10.1134/S1068162010061019 |