PPIRE06250
Target Protein Information
| Protein_Name | Gamma-aminobutyric acid receptor-associated protein-like 1 |
|---|---|
| Protein_Sequence | MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESVYGK |
| Organism_Source | Homo sapiens |
| Functional_Classification | ubiquitin-like proteins |
| Cellular_Localization | Cytoplasm |
| Gene_Names | GABARAPL1 |
| UniProt_ID | Q9H0R8 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | NBR1-LIR_S729E |
|---|---|
| Peptide_Sequence | EYIIIL |
| Peptide_Length | 6 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@@H](N)CCC(=O)O)C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@@H](CC(C)C)C(=O)O)[C@@H](C)CC)[C@@H](C)CC |
| Chemical_Modification | |
| Cyclization_Method | |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 762.94 |
|---|---|
| Aliphatic_Index | 260.00000 |
| Aromaticity | 0.16667 |
| Average_Rotatable_Bonds | 4.00000 |
| Charge_at_pH_7 | -1.00109 |
| Isoelectric_Point | 3.84998 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 9 |
| Number_of_Hydrogen_Bond_Donors | 9 |
| Topological_Polar_Surface_Area | 266.35000 |
| X_logP_energy | 1.81980 |
Interaction Information
| Affinity | KD=2.7 uM |
|---|---|
| Affinity_Assay | Isothermal titration calorimetry |
| PDB_ID | 2L8J |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Characterization of the interaction of GABARAPL-1 with the LIR motif of NBR1. |
| Release_Year | 2011 |
| PMID | 21620860 |
| DOI | 10.1016/j.jmb.2011.05.003 |