PPIRE06355
Target Protein Information
| Protein_Name | Immunoglobulin heavy constant gamma 3 |
|---|---|
| Protein_Sequence | ASTKGPSVFPLAPCSRSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYTCNVNHKPSNTKVDKRVELKTPLGDTTHTCPRCPEPKSCDTPPPCPRCPEPKSCDTPPPCPRCPEPKSCDTPPPCPRCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFKWYVDGVEVHNAKTKPREEQYNSTFRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESSGQPENNYNTTPPMLDSDGSFFLYSKLTVDKSRWQQGNIFSCSVMHEALHNRFTQKSLSLSPELQLEESCAEAQDGELDGLWTTITIFITLFLLSVCYSATVTFFKVKWIFSSVVDLKQTIIPDYRNMIGQGA |
| Organism_Source | Homo sapiens |
| Functional_Classification | immunoglobulins |
| Cellular_Localization | Extracellular |
| Gene_Names | IGHG3 |
| UniProt_ID | P01860 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | HWRGWV |
|---|---|
| Peptide_Sequence | HWRGWV |
| Peptide_Length | 6 |
| Peptide_SMILES | CC(C)[C@H](NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)CNC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@@H](N)Cc1c[nH]cn1)C(=O)O |
| Chemical_Modification | |
| Cyclization_Method | |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 839.95 |
|---|---|
| Aliphatic_Index | 48.33333 |
| Aromaticity | 0.33333 |
| Average_Rotatable_Bonds | 3.66667 |
| Charge_at_pH_7 | 1.08889 |
| Isoelectric_Point | 10.55176 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 9 |
| Number_of_Hydrogen_Bond_Donors | 13 |
| Topological_Polar_Surface_Area | 330.98000 |
| X_logP_energy | -0.21323 |
Interaction Information
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Chromatographic assay to probe the binding energy and mechanisms of homologous proteins to surface-bound ligands. |
| Release_Year | 2019 |
| PMID | 31841976 |
| DOI | 10.1016/j.jchromb.2019.121927 |