PPIRE06414
Target Protein Information
| Protein_Name | 14-3-3 protein sigma |
|---|---|
| Protein_Sequence | MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNAGEEGGEAPQEPQS |
| Organism_Source | Homo sapiens |
| Functional_Classification | adaptor proteins |
| Cellular_Localization | Cytoplasm |
| Gene_Names | SFN |
| UniProt_ID | P31947 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | TASK-ctp |
|---|---|
| Peptide_Sequence | KRRKSV |
| Peptide_Length | 6 |
| Peptide_SMILES | CC(C)[C@H](NC(=O)[C@H](CO)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@@H](N)CCCCN)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 772.95 |
|---|---|
| Aliphatic_Index | 48.33333 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 4.83333 |
| Charge_at_pH_7 | 3.99739 |
| Isoelectric_Point | 12.53175 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 12 |
| Number_of_Hydrogen_Bond_Donors | 16 |
| Topological_Polar_Surface_Area | 404.89000 |
| X_logP_energy | -4.74486 |
Interaction Information
| Affinity | EC50=12.4 mM |
|---|---|
| Affinity_Assay | Fluorescence Polarization |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | A semisynthetic fusicoccane stabilizes a protein-protein interaction and enhances the expression of K+ channels at the cell surface. |
| Release_Year | 2013 |
| PMID | 23601647 |
| DOI | 10.1016/j.chembiol.2013.03.015 |