PPIRE06426
Target Protein Information
| Protein_Name | Tumor necrosis factor |
|---|---|
| Protein_Sequence | MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL |
| Organism_Source | Homo sapiens |
| Functional_Classification | tumor necrosis factors |
| Cellular_Localization | Extracellular |
| Gene_Names | TNF |
| UniProt_ID | P01375 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | kwiivw |
|---|---|
| Peptide_Sequence | kwiivw |
| Peptide_Length | 6 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@@H](N)CCCCN)C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)O)C(C)C)[C@@H](C)CC |
| Chemical_Modification | |
| Cyclization_Method | |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Acetyl |
| C-terminal_Modification | amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 844.07 |
|---|---|
| Aliphatic_Index | 178.33333 |
| Aromaticity | 0.33333 |
| Average_Rotatable_Bonds | 4.00000 |
| Charge_at_pH_7 | 0.99769 |
| Isoelectric_Point | 9.70000 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 8 |
| Number_of_Hydrogen_Bond_Donors | 10 |
| Topological_Polar_Surface_Area | 266.42000 |
| X_logP_energy | 3.14750 |
Interaction Information
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Identification of TNF-alpha binding peptides from a D-amino acid hexapeptide library that specifically inhibit TNF-alpha binding to recombinant p55 receptor. |
| Release_Year | 1988 |
| PMID | 10080877 |
| DOI | 10.1006/cyto.1998.0389 |