PPIRE06484
Target Protein Information
| Protein_Name | cAMP-dependent protein kinase inhibitor alpha |
|---|---|
| Protein_Sequence | MTDVETTYADFIASGRTGRRNAIHDILVSSASGNSNELALKLAGLDINKTEGEEDAQRSSTEQSGEAQGEAAKSES |
| Organism_Source | Sus scrofa |
| Functional_Classification | protein kinase inhibitors |
| Cellular_Localization | Cytoplasm |
| Gene_Names | PKIA |
| UniProt_ID | Q71U53 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | CCK-6 |
|---|---|
| Peptide_Sequence | MGWMDF |
| Peptide_Length | 6 |
| Peptide_SMILES | CSCC[C@H](NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)CNC(=O)[C@@H](N)CCSC)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](Cc1ccccc1)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 785.93 |
|---|---|
| Aliphatic_Index | 0.00000 |
| Aromaticity | 0.33333 |
| Average_Rotatable_Bonds | 3.83333 |
| Charge_at_pH_7 | -1.00157 |
| Isoelectric_Point | 3.74999 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 10 |
| Number_of_Hydrogen_Bond_Donors | 9 |
| Topological_Polar_Surface_Area | 261.91000 |
| X_logP_energy | 0.40130 |
Interaction Information
| Affinity | EC50=9.3 uM |
|---|---|
| Affinity_Assay | tension recording assay |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Evidence that relaxation of hog biliary muscle is mediated by the interaction between the protein inhibitor of cyclic AMP dependent protein kinase and cholecystokinin C-terminal peptides. |
| Release_Year | 1983 |
| PMID | 6301500 |
| DOI | 10.1016/0006-2952(83)90578-6 |