PPIRE06637
Target Protein Information
| Protein_Name | Syntenin-1 |
|---|---|
| Protein_Sequence | MSLYPSLEDLKVDKVIQAQTAFSANPANPAILSEASAPIPHDGNLYPRLYPELSQYMGLSLNEEEIRANVAVVSGAPLQGQLVARPSSINYMVAPVTGNDVGIRRAEIKQGIREVILCKDQDGKIGLRLKSIDNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKITMTIRDRPFERTITMHKDSTGHVGFIFKNGKITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPAFIFEHIIKRMAPSIMKSLMDHTIPEV |
| Organism_Source | Homo sapiens |
| Functional_Classification | scaffold proteins |
| Cellular_Localization | Cytoplasm |
| Gene_Names | SDCBP |
| UniProt_ID | O00560 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | neurexin hexapeptide TNEYYV |
|---|---|
| Peptide_Sequence | TNEYYV |
| Peptide_Length | 6 |
| Peptide_SMILES | CC(C)[C@H](NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CC(N)=O)NC(=O)[C@@H](N)[C@@H](C)O)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 787.82 |
|---|---|
| Aliphatic_Index | 48.33333 |
| Aromaticity | 0.33333 |
| Average_Rotatable_Bonds | 3.66667 |
| Charge_at_pH_7 | -1.00194 |
| Isoelectric_Point | 3.84998 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 12 |
| Number_of_Hydrogen_Bond_Donors | 12 |
| Topological_Polar_Surface_Area | 349.90000 |
| X_logP_energy | -2.50410 |
Interaction Information
| Affinity | KD=0.74 mM |
|---|---|
| Affinity_Assay | heteronuclear NMR spectroscopy |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | The binding of the PDZ tandem of syntenin to target proteins. |
| Release_Year | 2006 |
| PMID | 16533050 |
| DOI | 10.1021/bi052225y |