PPIRE06695
Target Protein Information
| Protein_Name | N-formyl peptide receptor 2 |
|---|---|
| Protein_Sequence | METNFSTPLNEYEEVSYESAGYTVLRILPLVVLGVTFVLGVLGNGLVIWVAGFRMTRTVTTICYLNLALADFSFTATLPFLIVSMAMGEKWPFGWFLCKLIHIVVDINLFGSVFLIGFIALDRCICVLHPVWAQNHRTVSLAMKVIVGPWILALVLTLPVFLFLTTVTIPNGDTYCTFNFASWGGTPEERLKVAITMLTARGIIRFVIGFSLPMSIVAICYGLIAAKIHKKGMIKSSRPLRVLTAVVASFFICWFPFQLVALLGTVWLKEMLFYGKYKIIDILVNPTSSLAFFNSCLNPMLYVFVGQDFRERLIHSLPTSLERALSEDSAPTNDTAANSASPPAETELQAM |
| Organism_Source | Homo sapiens |
| Functional_Classification | G protein-coupled receptor |
| Cellular_Localization | Plasma membrane |
| Gene_Names | FPR2 |
| UniProt_ID | P25090 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | WKYMVM |
|---|---|
| Peptide_Sequence | WKYMVM |
| Peptide_Length | 6 |
| Peptide_SMILES | CSCC[C@H](NC(=O)[C@@H](NC(=O)[C@H](CCSC)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](N)Cc1c[nH]c2ccccc12)C(C)C)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 857.10 |
|---|---|
| Aliphatic_Index | 48.33333 |
| Aromaticity | 0.33333 |
| Average_Rotatable_Bonds | 4.33333 |
| Charge_at_pH_7 | 0.99684 |
| Isoelectric_Point | 9.29830 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 11 |
| Number_of_Hydrogen_Bond_Donors | 10 |
| Topological_Polar_Surface_Area | 270.86000 |
| X_logP_energy | 1.78580 |
Interaction Information
| Affinity | IC50=130 nM |
|---|---|
| Affinity_Assay | cell-based radioligand binding assay |
| PDB_ID | None |
| Type | Agonist |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | The synthetic peptide Trp-Lys-Tyr-Met-Val-Met-NH2 specifically activates neutrophils through FPRL1/lipoxin A4 receptors and is an agonist for the orphan monocyte-expressed chemoattractant receptor FPRL2. |
| Release_Year | 2001 |
| PMID | 11285256 |
| DOI | 10.1074/jbc.M007769200 |