PPIRE06879
Target Protein Information
| Protein_Name | SH2 domain-containing protein |
|---|---|
| Protein_Sequence | MEAMQKNELNSKIPIIFGLINSYQIHNLLEQHNAKTKESKAVFLIRDSSTYPGLLTISYYCQEQDIVKHIRFGLTDKGWKTAPKPPHEPLKSDSPEIKEKYTLDKIKFERKMKQFINTAKKLFEQHIRAESFKTLIMELKIHEFNLEGLIKPTRSQASQEKHFTDYV |
| Organism_Source | Legionella longbeachae serogroup 1 (strain NSW150) |
| Functional_Classification | SH2 domain |
| Cellular_Localization | Cytoplasm |
| Gene_Names | None |
| UniProt_ID | D3HJY4 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | GGpYGG |
|---|---|
| Peptide_Sequence | GGpYGG |
| Peptide_Length | 6 |
| Peptide_SMILES | NCC(=O)NCC(=O)N1CCC[C@H]1C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)NCC(=O)NCC(=O)O |
| Chemical_Modification | Y3=phosphotyrosine |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 506.52 |
|---|---|
| Aliphatic_Index | 0.00000 |
| Aromaticity | 0.16667 |
| Average_Rotatable_Bonds | 2.00000 |
| Charge_at_pH_7 | -0.00287 |
| Isoelectric_Point | 6.09320 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 8 |
| Number_of_Hydrogen_Bond_Donors | 7 |
| Topological_Polar_Surface_Area | 220.26000 |
| X_logP_energy | -3.19760 |
Interaction Information
| Affinity | KD=3.61 uM |
|---|---|
| Affinity_Assay | Fluorescence Polarization |
| PDB_ID | 6E8I |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Identification and characterization of a large family of superbinding bacterial SH2 domains. |
| Release_Year | 2018 |
| PMID | 30382091 |
| DOI | 10.1038/s41467-018-06943-2 |