PPIRE06932
Target Protein Information
| Protein_Name | Dynein light chain 1, cytoplasmic |
|---|---|
| Protein_Sequence | MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG |
| Organism_Source | Homo sapiens |
| Functional_Classification | motor proteins |
| Cellular_Localization | Cytoplasm |
| Gene_Names | DYNLL1 |
| UniProt_ID | P63167 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Ac-DKSTQTD |
|---|---|
| Peptide_Sequence | DKSTQTD |
| Peptide_Length | 7 |
| Peptide_SMILES | C[C@@H](O)[C@H](NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](NC(=O)[C@H](CO)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](N)CC(=O)O)[C@@H](C)O)C(=O)N[C@@H](CC(=O)O)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Acetyl |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 793.79 |
|---|---|
| Aliphatic_Index | 0.00000 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 3.85714 |
| Charge_at_pH_7 | -1.00142 |
| Isoelectric_Point | 4.10925 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 15 |
| Number_of_Hydrogen_Bond_Donors | 15 |
| Topological_Polar_Surface_Area | 442.32000 |
| X_logP_energy | -7.59510 |
Interaction Information
| Affinity | KD=5.6 mM |
|---|---|
| Affinity_Assay | Isothermal titration calorimetry |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Directed evolution reveals the binding motif preference of the LC8/DYNLL hub protein and predicts large numbers of novel binders in the human proteome. |
| Release_Year | 2011 |
| PMID | 21533121 |
| DOI | 10.1371/journal.pone.0018818 |