PPIRE07033
Target Protein Information
| Protein_Name | Tax1-binding protein 3 |
|---|---|
| Protein_Sequence | MSYIPGQPVTAVVQRVEIHKLRQGENLILGFSIGGGIDQDPSQNPFSEDKTDKGIYVTRVSEGGPAEIAGLQIGDKIMQVNGWDMTMVTHDQARKRLTKRSEEVVRLLVTRQSLQKAVQQSMLS |
| Organism_Source | Homo sapiens |
| Functional_Classification | PDZ domain-containing protein |
| Cellular_Localization | Plasma membrane |
| Gene_Names | TAX1BP3 |
| UniProt_ID | O14907 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | HVGGSSV |
|---|---|
| Peptide_Sequence | HVGGSSV |
| Peptide_Length | 7 |
| Peptide_SMILES | CC(C)[C@H](NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)CNC(=O)CNC(=O)[C@@H](NC(=O)[C@@H](N)Cc1c[nH]cn1)C(C)C)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 641.68 |
|---|---|
| Aliphatic_Index | 82.85714 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 2.71429 |
| Charge_at_pH_7 | 0.08889 |
| Isoelectric_Point | 7.55032 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 11 |
| Number_of_Hydrogen_Bond_Donors | 11 |
| Topological_Polar_Surface_Area | 307.06000 |
| X_logP_energy | -5.16770 |
Interaction Information
| Affinity | KD=3.3 uM |
|---|---|
| Affinity_Assay | Surface plasmon resonance |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | PEGylated peptide to TIP1 is a novel targeting agent that binds specifically to various cancers in vivo. |
| Release_Year | 2019 |
| PMID | 30763622 |
| DOI | 10.1016/j.jconrel.2019.02.008 |