PPIRE07107
Target Protein Information
| Protein_Name | Tumor necrosis factor |
|---|---|
| Protein_Sequence | MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL |
| Organism_Source | Homo sapiens |
| Functional_Classification | tumor necrosis factor family |
| Cellular_Localization | Extracellular |
| Gene_Names | TNF |
| UniProt_ID | P01375 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | P51 |
|---|---|
| Peptide_Sequence | NLMSRPI |
| Peptide_Length | 7 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@@H]1CCCN1C(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CO)NC(=O)[C@H](CCSC)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](N)CC(N)=O)C(=O)O |
| Chemical_Modification | |
| Cyclization_Method | |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 830.01 |
|---|---|
| Aliphatic_Index | 111.42857 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 3.71429 |
| Charge_at_pH_7 | 0.99798 |
| Isoelectric_Point | 10.55000 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 12 |
| Number_of_Hydrogen_Bond_Donors | 12 |
| Topological_Polar_Surface_Area | 354.35000 |
| X_logP_energy | -3.21043 |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Identification of novel peptides against TNF-Alpha using phage display technique and in silico modeling of their modes of binding. |
| Release_Year | 2016 |
| PMID | 27720899 |
| DOI | 10.1016/j.ejps.2016.10.005 |