PPIRE07154
Target Protein Information
| Protein_Name | Pancreatic alpha-amylase |
|---|---|
| Protein_Sequence | MKFVLLLSLIGFCWAQYDPHTADGRTAIVHLFEWRWADIAKECERYLAPKGFGGVQVSPPNENIIINNPSRPWWERYQPISYKICSRSGNENEFKDMVTRCNNVGVRIYVDAVINHMCGSGNSAGTHSTCGSYFNPNNREFSAVPYSAWYFNDNKCNGEINNYNDANQVRNCRLSGLLDLALDKDYVRTKVADYMNNLIDIGVAGFRLDAAKHMWPGDIKAVLDKLHNLNTKWFSQGSRPFIFQEVIDLGGEAIKGSEYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPTDRALVFVDNHDNQRGHGAGGASILTFWDARMYKMAVGFMLAHPYGFTRVMSSYRRTRNFQNGKDVNDWIGPPNNNGVTKEVTINPDTTCGNDWVCEHRWRQIRNMVAFRNVVNGQPFANWWDNGSNQVAFSRGNRGFIVFNNDDWALSSTLQTGLPAGTYCDVISGDKVNGNCTGLKVNVGSDGKAHFSISNSAEDPFIAIHADSKL |
| Organism_Source | Rattus norvegicus |
| Functional_Classification | glycoside hydrolases |
| Cellular_Localization | Extracellular |
| Gene_Names | Amy2 |
| UniProt_ID | P00689 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | PBP6 |
|---|---|
| Peptide_Sequence | PPHMGGP |
| Peptide_Length | 7 |
| Peptide_SMILES | CSCC[C@H](NC(=O)[C@H](Cc1c[nH]cn1)NC(=O)[C@@H]1CCCN1C(=O)[C@@H]1CCCN1)C(=O)NCC(=O)NCC(=O)N1CCC[C@H]1C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 691.80 |
|---|---|
| Aliphatic_Index | 0.00000 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 2.28571 |
| Charge_at_pH_7 | 0.08889 |
| Isoelectric_Point | 7.55032 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 10 |
| Number_of_Hydrogen_Bond_Donors | 7 |
| Topological_Polar_Surface_Area | 235.03000 |
| X_logP_energy | -2.27410 |
Interaction Information
| Affinity | IC50=6.14 mM |
|---|---|
| Affinity_Assay | DNS assay |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | The investigation of Alpha-amylase inhibitory activity of selected Pinto bean peptides via preclinical study using AR42J cell |
| Release_Year | 2017 |
| PMID | None |
| DOI | 10.1016/j.jff.2017.06.037 |