PPIRE07240
Target Protein Information
| Protein_Name | Gamma-aminobutyric acid receptor-associated protein-like 1 |
|---|---|
| Protein_Sequence | MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESVYGK |
| Organism_Source | Homo sapiens |
| Functional_Classification | ubiquitin-like proteins |
| Cellular_Localization | Cytoplasm |
| Gene_Names | GABARAPL1 |
| UniProt_ID | Q9H0R8 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | ATG14 LIR |
|---|---|
| Peptide_Sequence | TDWENLP |
| Peptide_Length | 7 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@H](CC(=O)O)NC(=O)[C@@H](N)[C@@H](C)O)C(=O)N1CCC[C@H]1C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 873.92 |
|---|---|
| Aliphatic_Index | 55.71429 |
| Aromaticity | 0.14286 |
| Average_Rotatable_Bonds | 3.42857 |
| Charge_at_pH_7 | -1.99979 |
| Isoelectric_Point | 3.55007 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 12 |
| Number_of_Hydrogen_Bond_Donors | 12 |
| Topological_Polar_Surface_Area | 382.84000 |
| X_logP_energy | -2.82090 |
Interaction Information
| Affinity | KD=1.9 uM |
|---|---|
| Affinity_Assay | Bio-Layer Interferometry |
| PDB_ID | 6HOK |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Members of the autophagy class III phosphatidylinositol 3-kinase complex I interact with GABARAP and GABARAPL1 via LIR motifs. |
| Release_Year | 2019 |
| PMID | 30767700 |
| DOI | 10.1080/15548627.2019.1581009 |