PPIRE07295
Target Protein Information
| Protein_Name | Annexin A5 |
|---|---|
| Protein_Sequence | MAQVLRGTVTDFPGFDERADAETLRKAMKGLGTDEESILTLLTSRSNAQRQEISAAFKTLFGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQANRDPDAGIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVMVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLCGEDD |
| Organism_Source | Homo sapiens |
| Functional_Classification | annexins |
| Cellular_Localization | Extracellular |
| Gene_Names | ANXA5 |
| UniProt_ID | P08758 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | FBz-LIKKPF |
|---|---|
| Peptide_Sequence | XLIKKPF |
| Peptide_Length | 7 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](CC(C)C)NC(=O)CN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N1CCC[C@H]1C(=O)N[C@@H](Cc1ccccc1)C(=O)O |
| Chemical_Modification | X1=4-fluorobenzoyl |
| Cyclization_Method | |
| Linear/Cyclic | Linear |
| N-terminal_Modification | 4-Fluorobenzoylation |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 802.03 |
|---|---|
| Aliphatic_Index | 111.42857 |
| Aromaticity | 0.14286 |
| Average_Rotatable_Bonds | 3.71429 |
| Charge_at_pH_7 | 1.99739 |
| Isoelectric_Point | 10.80538 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 10 |
| Number_of_Hydrogen_Bond_Donors | 9 |
| Topological_Polar_Surface_Area | 281.17000 |
| X_logP_energy | 0.03760 |
Interaction Information
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Radiopharmacological evaluation of (18)F-labeled phosphatidylserine-binding peptides for molecular imaging of apoptosis. |
| Release_Year | 2015 |
| PMID | 26205076 |
| DOI | 10.1016/j.nucmedbio.2015.06.011 |