PPIRE07353
Target Protein Information
| Protein_Name | None |
|---|---|
| Protein_Sequence | FLDGIDKAQEEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEFGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPVWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED |
| Organism_Source | Human immunodeficiency virus type 1 |
| Functional_Classification | endonucleases |
| Cellular_Localization | Nucleus |
| Gene_Names | None |
| UniProt_ID | Q76353 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | b3 |
|---|---|
| Peptide_Sequence | YIEAEVI |
| Peptide_Length | 7 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@@H](NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](C)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@@H](NC(=O)[C@@H](N)Cc1ccc(O)cc1)[C@@H](C)CC)C(C)C)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 835.95 |
|---|---|
| Aliphatic_Index | 167.14286 |
| Aromaticity | 0.14286 |
| Average_Rotatable_Bonds | 3.71429 |
| Charge_at_pH_7 | -1.99932 |
| Isoelectric_Point | 3.61369 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 11 |
| Number_of_Hydrogen_Bond_Donors | 11 |
| Topological_Polar_Surface_Area | 332.75000 |
| X_logP_energy | -0.24690 |
Interaction Information
| Affinity | IC50=1 mM |
|---|---|
| Affinity_Assay | Enzyme Inhibition Kinetics |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Interfacial peptide inhibitors of HIV-1 integrase activity and dimerization. |
| Release_Year | 2003 |
| PMID | 12643937 |
| DOI | 10.1016/S0960-894X(03)00040-4 |