PPIRE07431
Target Protein Information
| Protein_Name | Melanocortin receptor 3 |
|---|---|
| Protein_Sequence | MNASCCLPSVQPTLPNGSEHLQAPFFSNQSSSAFCEQVFIKPEVFLSLGIVSLLENILVILAVVRNGNLHSPMYFFLCSLAVADMLVSVSNALETIMIAIVHSDYLTFEDQFIQHMDNIFDSMICISLVASICNLLAIAVDRYVTIFYALRYHSIMTVRKALTLIVAIWVCCGVCGVVFIVYSESKMVIVCLITMFFAMMLLMGTLYVHMFLFARLHVKRIAALPPADGVAPQQHSCMKGAVTITILLGVFIFCWAPFFLHLVLIITCPTNPYCICYTAHFNTYLVLIMCNSVIDPLIYAFRSLELRNTFREILCGCNGMNLG |
| Organism_Source | Homo sapiens |
| Functional_Classification | G protein-coupled receptor |
| Cellular_Localization | Plasma membrane |
| Gene_Names | MC3R |
| UniProt_ID | P41968 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Ac-Nle-cyclo[Asp-Pro-dPhe-Arg-Trp-Lys]-NH2 |
|---|---|
| Peptide_Sequence | XDPfRWK |
| Peptide_Length | 7 |
| Peptide_SMILES | N=C(N)NCCC[C@H](NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@@H]1CCCN1C(=O)[C@H](CC(=O)O)NC(=O)CN)C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)N[C@@H](CCCCN)C(=O)O |
| Chemical_Modification | X1=norleucine |
| Cyclization_Method | Side chain-side chain cyclization; D2<->K7; amide bond |
| Linear/Cyclic | Cyclic |
| N-terminal_Modification | Acetyl |
| C-terminal_Modification | amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 905.02 |
|---|---|
| Aliphatic_Index | 0.00000 |
| Aromaticity | 0.28571 |
| Average_Rotatable_Bonds | 3.71429 |
| Charge_at_pH_7 | 0.99813 |
| Isoelectric_Point | 9.69502 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 11 |
| Number_of_Hydrogen_Bond_Donors | 13 |
| Topological_Polar_Surface_Area | 370.14000 |
| X_logP_energy | -1.72163 |
Interaction Information
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Design of a new peptidomimetic agonist for the melanocortin receptors based on the solution structure of the peptide ligand, Ac-Nle-cyclo[Asp-Pro-DPhe-Arg-Trp-Lys]-NH(2). |
| Release_Year | 2003 |
| PMID | 12824029 |
| DOI | 10.1016/S0960-894X(03)00412-8 |