PPIRE07524
Target Protein Information
| Protein_Name | |
|---|---|
| Protein_Sequence | MTEQSTKSLRLGVFAAIILGLVGTGFGIYQLVKEKDLAQEIANVKSTVNQVKDAEGVTFKSKAEFEAAVAESINKFVAQKQQADIDQKYAQFEAAPEKVEDGKHIYGDLGARFTLVEFSDMECPFCKQFHDTPKQIVDASKGNVNWQWKHMPLDFHNPAAHKEALAAECIAEQKGNRGFWVFVNEIFHHSKGNGAGVSDLASVVTGVGADLDAFRECLSSGKHEDKVQADIQKAKSYGVNGTPATFVVDNQTGKSQLLGGAQPAQAIMAVMRKMMIESQQDDSANQ |
| Organism_Source | Proteus mirabilis |
| Functional_Classification | oxidoreductases |
| Cellular_Localization | Extracellular |
| Gene_Names | dsbA |
| UniProt_ID | A0A6B9T123 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | PWATCDS |
|---|---|
| Peptide_Sequence | PWATCDS |
| Peptide_Length | 7 |
| Peptide_SMILES | C[C@H](NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@@H]1CCCN1)C(=O)N[C@H](C(=O)N[C@@H](CS)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CO)C(=O)O)[C@@H](C)O |
| Chemical_Modification | |
| Cyclization_Method | |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Acetyl |
| C-terminal_Modification | amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 778.83 |
|---|---|
| Aliphatic_Index | 14.28571 |
| Aromaticity | 0.14286 |
| Average_Rotatable_Bonds | 2.85714 |
| Charge_at_pH_7 | -1.06354 |
| Isoelectric_Point | 3.74997 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 12 |
| Number_of_Hydrogen_Bond_Donors | 13 |
| Topological_Polar_Surface_Area | 317.48000 |
| X_logP_energy | -3.74670 |
Interaction Information
| Affinity | KD=8.3 uM |
|---|---|
| Affinity_Assay | Isothermal titration calorimetry |
| PDB_ID | 4OD7 |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Crystal structure of the dithiol oxidase DsbA enzyme from proteus mirabilis bound non-covalently to an active site peptide ligand. |
| Release_Year | 2014 |
| PMID | 24831013 |
| DOI | 10.1074/jbc.M114.552380 |