PPIRE07553
Target Protein Information
| Protein_Name | Kallikrein-2 |
|---|---|
| Protein_Sequence | MWDLVLSIALSVGCTGAVPLIQSRIVGGWECEKHSQPWQVAVYSHGWAHCGGVLVHPQWVLTAAHCLKKNSQVWLGRHNLFEPEDTGQRVPVSHSFPHPLYNMSLLKHQSLRPDEDSSHDLMLLRLSEPAKITDVVKVLGLPTQEPALGTTCYASGWGSIEPEEFLRPRSLQCVSLHLLSNDMCARAYSEKVTEFMLCAGLWTGGKDTCGGDSGGPLVCNGVLQGITSWGPEPCALPEKPAVYTKVVHYRKWIKDTIAANP |
| Organism_Source | Homo sapiens |
| Functional_Classification | serine proteases |
| Cellular_Localization | Extracellular |
| Gene_Names | KLK2 |
| UniProt_ID | P20151 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | ARFKVWWG |
|---|---|
| Peptide_Sequence | ARFKVWWG |
| Peptide_Length | 8 |
| Peptide_SMILES | CC(C)[C@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](C)N)C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)NCC(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1049.24 |
|---|---|
| Aliphatic_Index | 48.75000 |
| Aromaticity | 0.37500 |
| Average_Rotatable_Bonds | 3.75000 |
| Charge_at_pH_7 | 1.99769 |
| Isoelectric_Point | 11.65178 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 11 |
| Number_of_Hydrogen_Bond_Donors | 15 |
| Topological_Polar_Surface_Area | 386.52000 |
| X_logP_energy | 0.18217 |
Interaction Information
| Affinity | IC50=4.4 uM |
|---|---|
| Affinity_Assay | Enzyme Inhibition Kinetics |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Evaluation of peptides as protease inhibitors and stimulators. |
| Release_Year | 2014 |
| PMID | 24146402 |
| DOI | 10.1007/978-1-62703-673-3_10 |