PPIRE07663
Target Protein Information
| Protein_Name | B1 bradykinin receptor |
|---|---|
| Protein_Sequence | MASQASLKLQPSNQSQQAPPNITSCEGAPEAWDLLCRVLPGFVITVCFFGLLGNLLVLSFFLLPWRRWWQQRRQRLTIAEIYLANLAASDLVFVLGLPFWAENVGNRFNWPFGSDLCRVVSGVIKANLFISIFLVVAISQDRYRLLVYPMTSWGNRRRRQAQVTCLLIWVAGGLLSTPTFLLRSVKVVPDLNISACILLFPHEAWHFVRMVELNVLGFLLPLAAILYFNFHILASLRGQKEASRTRCGGPKDSKTMGLILTLVASFLVCWAPYHFFAFLDFLVQVRVIQDCFWKELTDLGLQLANFFAFVNSCLNPLIYVFAGRLFKTRVLGTL |
| Organism_Source | Mus musculus |
| Functional_Classification | G protein-coupled receptor |
| Cellular_Localization | Plasma membrane |
| Gene_Names | Bdkrb1 |
| UniProt_ID | Q61125 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Ovokinin |
|---|---|
| Peptide_Sequence | FRADHPFL |
| Peptide_Length | 8 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@@H]1CCCN1C(=O)[C@H](Cc1c[nH]cn1)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](C)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@@H](N)Cc1ccccc1)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1002.14 |
|---|---|
| Aliphatic_Index | 61.25000 |
| Aromaticity | 0.25000 |
| Average_Rotatable_Bonds | 3.50000 |
| Charge_at_pH_7 | 0.08934 |
| Isoelectric_Point | 7.55094 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 12 |
| Number_of_Hydrogen_Bond_Donors | 13 |
| Topological_Polar_Surface_Area | 386.11000 |
| X_logP_energy | -1.44673 |
Interaction Information
| Affinity | IC50=64 nM |
|---|---|
| Affinity_Assay | radioligand binding assay |
| PDB_ID | None |
| Type | Agonist |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Isolation and characterization of ovokinin, a bradykinin B1 agonist peptide derived from ovalbumin. |
| Release_Year | 1995 |
| PMID | 7479316 |
| DOI | 10.1016/0196-9781(95)00054-n |