PPIRE07693
Target Protein Information
| Protein_Name | Proliferating cell nuclear antigen |
|---|---|
| Protein_Sequence | MLEAKFEEASLFKRIIDGFKDCVQLVNFQCKEDGIIAQAVDDSRVLLVSLEIGVEAFQEYRCDHPVTLGMDLTSLSKILRCGNNTDTLTLIADNTPDSIILLFEDTKKDRIAEYSLKLMDIDADFLKIEELQYDSTLSLPSSEFSKIVRDLSQLSDSINIMITKETIKFVADGDIGSGSVIIKPFVDMEHPETSIKLEMDQPVDLTFGAKYLLDIIKGSSLSDRVGIRLSSEAPALFQFDLKSGFLQFFLAPKFNDEE |
| Organism_Source | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) |
| Functional_Classification | processivity factors |
| Cellular_Localization | Nucleus |
| Gene_Names | POL30 |
| UniProt_ID | P15873 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Pif1 PCNA-binding peptide |
|---|---|
| Peptide_Sequence | GIAAMLQR |
| Peptide_Length | 8 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)CN)C(=O)N[C@@H](C)C(=O)N[C@@H](C)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(=N)N)C(=O)O |
| Chemical_Modification | |
| Cyclization_Method | |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 859.05 |
|---|---|
| Aliphatic_Index | 122.50000 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 3.62500 |
| Charge_at_pH_7 | 0.99798 |
| Isoelectric_Point | 10.55000 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 12 |
| Number_of_Hydrogen_Bond_Donors | 13 |
| Topological_Polar_Surface_Area | 372.01000 |
| X_logP_energy | -3.16283 |
Interaction Information
| Affinity | KD=19 uM |
|---|---|
| Affinity_Assay | Isothermal titration calorimetry |
| PDB_ID | 6B8I |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Role of the Pif1-PCNA Complex in Pol Delte-Dependent Strand Displacement DNA Synthesis and Break-Induced Replication. |
| Release_Year | 2017 |
| PMID | 29141206 |
| DOI | 10.1016/j.celrep.2017.10.079 |