PPIRE07739
Target Protein Information
| Protein_Name | H-2 class I histocompatibility antigen, K-Q alpha chain |
|---|---|
| Protein_Sequence | PRFISVGYVDDTELVRFDSDAENPRYEPRARWMEQVEPEYWERNTQIAKDNEQSSRVDLRTLLRYYNQSAGGSHTIQRMYGCDVGSDGRLLRGYEQVAYDGCDYIALNEDLKTWTAADMAALITKHKWEQAGAAERRRAYLEGACVEWLSRHLKNGNATLLRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQYYTCHVYHQGLPKPLTLRWEPPPSAVSNTVIIAVLVVLGAAIVTGAVVAFVMMRRRNTGGKGGDYALAPGSQTSDLSLPDCKVMVHDPHSLA |
| Organism_Source | Mus musculus |
| Functional_Classification | MHC class I |
| Cellular_Localization | Plasma membrane |
| Gene_Names | H2-K1 |
| UniProt_ID | P14428 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | pBM1 |
|---|---|
| Peptide_Sequence | INFDFNTI |
| Peptide_Length | 8 |
| Peptide_SMILES | CC[C@H](C)[C@H](N)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@H](C(=O)N[C@H](C(=O)O)[C@@H](C)CC)[C@@H](C)O |
| Chemical_Modification | |
| Cyclization_Method | |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 983.09 |
|---|---|
| Aliphatic_Index | 97.50000 |
| Aromaticity | 0.25000 |
| Average_Rotatable_Bonds | 3.75000 |
| Charge_at_pH_7 | -1.00157 |
| Isoelectric_Point | 3.74999 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 13 |
| Number_of_Hydrogen_Bond_Donors | 13 |
| Topological_Polar_Surface_Area | 410.73000 |
| X_logP_energy | -3.02420 |
Interaction Information
| Affinity | KD=2.6 uM |
|---|---|
| Affinity_Assay | Surface plasmon resonance |
| PDB_ID | 1FO0 |
| Type | Agonist |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Structure activity relationship modelling of milk protein-derived peptides with dipeptidyl peptidase IV (DPP-IV)inhibitory activity. |
| Release_Year | 2000 |
| PMID | |
| DOI | 10.1038/ni0400-291 |