PPIRE07756
Target Protein Information
| Protein_Name | Ig gamma-1 chain C region secreted form |
|---|---|
| Protein_Sequence | AKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPRDCGCKPCICTVPEVSSVFIFPPKPKDVLTITLTPKVTCVVVDISKDDPEVQFSWFVDDVEVHTAQTQPREEQFNSTFRSVSELPIMHQDWLNGKEFKCRVNSAAFPAPIEKTISKTKGRPKAPQVYTIPPPKEQMAKDKVSLTCMITDFFPEDITVEWQWNGQPAENYKNTQPIMNTNGSYFVYSKLNVQKSNWEAGNTFTCSVLHEGLHNHHTEKSLSHSPGK |
| Organism_Source | Mus musculus |
| Functional_Classification | immunoglobulin |
| Cellular_Localization | Extracellular |
| Gene_Names | Ighg1 |
| UniProt_ID | P01868 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | truncated c-myc epitope peptide |
|---|---|
| Peptide_Sequence | KLISEEDL |
| Peptide_Length | 8 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](N)CCCCN)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CC(C)C)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 946.07 |
|---|---|
| Aliphatic_Index | 146.25000 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 4.25000 |
| Charge_at_pH_7 | -1.99831 |
| Isoelectric_Point | 3.92755 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 14 |
| Number_of_Hydrogen_Bond_Donors | 14 |
| Topological_Polar_Surface_Area | 425.17000 |
| X_logP_energy | -2.74420 |
Interaction Information
| Affinity | KD=25 uM |
|---|---|
| Affinity_Assay | Isothermal titration calorimetry |
| PDB_ID | 2OR9 |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | The structure of the anti-c-myc antibody 9E10 Fab fragment/epitope peptide complex reveals a novel binding mode dominated by the heavy chain hypervariable loops. |
| Release_Year | 2008 |
| PMID | 18473392 |
| DOI | 10.1002/prot.22080 |