PPIRE07918
Target Protein Information
| Protein_Name | 14-3-3 protein gamma |
|---|---|
| Protein_Sequence | MVDREQLVQKARLAEQAERYDDMAAAMKNVTELNEPLSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTSADGNEKKIEMVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYESKVFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQPTHPIRLGLALNYSVFYYEIQNAPEQACHLAKTAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDDDGGEGNN |
| Organism_Source | Homo sapiens |
| Functional_Classification | scaffold proteins |
| Cellular_Localization | Cytoplasm |
| Gene_Names | YWHAG |
| UniProt_ID | P61981 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | pepS100 |
|---|---|
| Peptide_Sequence | RKLXLQER |
| Peptide_Length | 8 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)CNC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](N)CCCNC(=N)N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CCCNC(=N)N)C(=O)O |
| Chemical_Modification | X4=phosphoserine |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 999.18 |
|---|---|
| Aliphatic_Index | 97.50000 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 4.62500 |
| Charge_at_pH_7 | 1.99946 |
| Isoelectric_Point | 11.47970 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 14 |
| Number_of_Hydrogen_Bond_Donors | 18 |
| Topological_Polar_Surface_Area | 497.23000 |
| X_logP_energy | -4.69866 |
Interaction Information
| Affinity | KD=9 uM |
|---|---|
| Affinity_Assay | Fluorescence Polarization |
| PDB_ID | 6EWW |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | 14-3-3 protein directly interacts with the kinase domain of calcium/calmodulin-dependent protein kinase kinase (CaMKK2). |
| Release_Year | 2018 |
| PMID | 29649512 |
| DOI | 10.1016/j.bbagen.2018.04.006 |