PPIRE07925
Target Protein Information
| Protein_Name | Proteasome subunit beta type-5 |
|---|---|
| Protein_Sequence | MALASVLQRPMPVNQHGFFGLGGRADLLDLGPGSPGDGLSLAAPSWGVPEEPRIEMLHGTTTLAFKFQHGVIVAADSRATAGPYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGTAFSVGSGSVYAFGVMDRGYSYDLQVEEAYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHDKYTSSIP |
| Organism_Source | Rattus norvegicus |
| Functional_Classification | proteases |
| Cellular_Localization | Cytoplasm |
| Gene_Names | Psmb5 |
| UniProt_ID | P28075 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | (Arg)8 |
|---|---|
| Peptide_Sequence | RRRRRRRR |
| Peptide_Length | 8 |
| Peptide_SMILES | N=C(N)NCCC[C@H](NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@@H](N)CCCNC(=N)N)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1267.52 |
|---|---|
| Aliphatic_Index | 0.00000 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 5.87500 |
| Charge_at_pH_7 | 7.99796 |
| Isoelectric_Point | 13.34511 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 17 |
| Number_of_Hydrogen_Bond_Donors | 33 |
| Topological_Polar_Surface_Area | 762.22000 |
| X_logP_energy | -10.10194 |
Interaction Information
| Affinity | IC50=100 nM |
|---|---|
| Affinity_Assay | Enzyme Inhibition Kinetics |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | The cell-penetrating peptide octa-arginine is a potent inhibitor of proteasome activities. |
| Release_Year | 2009 |
| PMID | 19027853 |
| DOI | 10.1016/j.ejpb.2008.10.016 |