PPIRE07972
Target Protein Information
| Protein_Name | H-2 class I histocompatibility antigen, K-Q alpha chain |
|---|---|
| Protein_Sequence | PRFISVGYVDDTELVRFDSDAENPRYEPRARWMEQVEPEYWERNTQIAKDNEQSSRVDLRTLLRYYNQSAGGSHTIQRMYGCDVGSDGRLLRGYEQVAYDGCDYIALNEDLKTWTAADMAALITKHKWEQAGAAERRRAYLEGACVEWLSRHLKNGNATLLRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQYYTCHVYHQGLPKPLTLRWEPPPSAVSNTVIIAVLVVLGAAIVTGAVVAFVMMRRRNTGGKGGDYALAPGSQTSDLSLPDCKVMVHDPHSLA |
| Organism_Source | Mus musculus |
| Functional_Classification | MHC class I molecules |
| Cellular_Localization | Plasma membrane |
| Gene_Names | H2-K1 |
| UniProt_ID | P14428 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | SIY |
|---|---|
| Peptide_Sequence | SIYRYYGL |
| Peptide_Length | 8 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@@H](N)CO)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1034.18 |
|---|---|
| Aliphatic_Index | 97.50000 |
| Aromaticity | 0.37500 |
| Average_Rotatable_Bonds | 3.75000 |
| Charge_at_pH_7 | 0.99543 |
| Isoelectric_Point | 9.06655 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 14 |
| Number_of_Hydrogen_Bond_Donors | 16 |
| Topological_Polar_Surface_Area | 409.84000 |
| X_logP_energy | -1.38403 |
Interaction Information
| Affinity | KD=22.1 uM |
|---|---|
| Affinity_Assay | Surface plasmon resonance |
| PDB_ID | 1KJ2 |
| Type | Agonist |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Distinct CDR3 conformations in TCRs determine the level of cross-reactivity for diverse antigens, but not the docking orientation. |
| Release_Year | 2008 |
| PMID | 18941216 |
| DOI | 10.4049/jimmunol.181.9.6255 |