PPIRE08033
Target Protein Information
| Protein_Name | Urokinase plasminogen activator surface receptor |
|---|---|
| Protein_Sequence | MGHPPLLPLLLLLHTCVPASWGLRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEELELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISCGSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGEEGRPKDDRHLRGCGYLPGCPGSNGFHNNDTFHFLKCCNTTKCNEGPILELENLPQNGRQCYSCKGNSTHGCSSEETFLIDCRGPMNQCLVATGTHEPKNQSYMVRGCATASMCQHAHLGDAFSMNHIDVSCCTKSGCNHPDLDVQYRSGAAPQPGPAHLSLTITLLMTARLWGGTLLWT |
| Organism_Source | Homo sapiens |
| Functional_Classification | GPI-anchored receptors |
| Cellular_Localization | Extracellular |
| Gene_Names | PLAUR |
| UniProt_ID | Q03405 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | AE101 |
|---|---|
| Peptide_Sequence | XfsrYLWS |
| Peptide_Length | 8 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CO)NC(=O)[C@H](Cc1ccccc1)NC(=O)CN)C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)N[C@@H](CO)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1015.14 |
|---|---|
| Aliphatic_Index | 48.75000 |
| Aromaticity | 0.37500 |
| Average_Rotatable_Bonds | 3.62500 |
| Charge_at_pH_7 | 0.99713 |
| Isoelectric_Point | 9.34881 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 13 |
| Number_of_Hydrogen_Bond_Donors | 16 |
| Topological_Polar_Surface_Area | 405.40000 |
| X_logP_energy | -2.36773 |
Interaction Information
| Affinity | KD=0.93 nM |
|---|---|
| Affinity_Assay | Surface plasmon resonance |
| PDB_ID | None |
| Type | antagonist |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Peptide-derived antagonists of the urokinase receptor. affinity maturation by combinatorial chemistry, identification of functional epitopes, and inhibitory effect on cancer cell intravasation. |
| Release_Year | 2001 |
| PMID | 11580291 |
| DOI | 10.1021/bi010662g |