PPIRE08124
Target Protein Information
| Protein_Name | Somatostatin receptor type 2 |
|---|---|
| Protein_Sequence | MELTSEQFNGSQVWIPSPFDLNGSLGPSNGSNQTEPYYDMTSNAVLTFIYFVVCVVGLCGNTLVIYVILRYAKMKTITNIYILNLAIADELFMLGLPFLAMQVALVHWPFGKAICRVVMTVDGINQFTSIFCLTVMSIDRYLAVVHPIKSAKWRRPRTAKMINVAVWGVSLLVILPIMIYAGLRSNQWGRSSCTINWPGESGAWYTGFIIYAFILGFLVPLTIICLCYLFIIIKVKSSGIRVGSSKRKKSEKKVTRMVSIVVAVFIFCWLPFYIFNVSSVSVAISPTPALKGMFDFVVILTYANSCANPILYAFLSDNFKKSFQNVLCLVKVSGAEDGERSDSKQDKSRLNETTETQRTLLNGDLQTSI |
| Organism_Source | Rattus norvegicus |
| Functional_Classification | G protein-coupled receptor |
| Cellular_Localization | Plasma membrane |
| Gene_Names | Sstr2 |
| UniProt_ID | P30680 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Tyr3-octreotate |
|---|---|
| Peptide_Sequence | fCYwKTCT |
| Peptide_Length | 8 |
| Peptide_SMILES | C[C@@H](O)[C@H](NC(=O)[C@H](CS)NC(=O)[C@@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](CS)NC(=O)[C@@H](N)Cc1ccccc1)[C@@H](C)O)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | Side chain-side chain cyclization; C2<->C7; disulfide bond |
| Linear/Cyclic | Cyclic |
| N-terminal_Modification | Maleimido |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1051.24 |
|---|---|
| Aliphatic_Index | 0.00000 |
| Aromaticity | 0.37500 |
| Average_Rotatable_Bonds | 3.62500 |
| Charge_at_pH_7 | 0.87289 |
| Isoelectric_Point | 8.22117 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 15 |
| Number_of_Hydrogen_Bond_Donors | 16 |
| Topological_Polar_Surface_Area | 369.52000 |
| X_logP_energy | -1.54290 |
Interaction Information
| Affinity | IC50=1.88 nM |
|---|---|
| Affinity_Assay | radioligand competition binding assay |
| PDB_ID | None |
| Type | Agonist |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Preparation and evaluation of tumor-targeting peptide-oligonucleotide conjugates. |
| Release_Year | 2000 |
| PMID | 11087334 |
| DOI | 10.1021/bc000041k |