PPIRE08154
Target Protein Information
| Protein_Name | Somatostatin receptor type 2 |
|---|---|
| Protein_Sequence | MELTSEQFNGSQVWIPSPFDLNGSLGPSNGSNQTEPYYDMTSNAVLTFIYFVVCVVGLCGNTLVIYVILRYAKMKTITNIYILNLAIADELFMLGLPFLAMQVALVHWPFGKAICRVVMTVDGINQFTSIFCLTVMSIDRYLAVVHPIKSAKWRRPRTAKMINVAVWGVSLLVILPIMIYAGLRSNQWGRSSCTINWPGESGAWYTGFIIYAFILGFLVPLTIICLCYLFIIIKVKSSGIRVGSSKRKKSEKKVTRMVSIVVAVFIFCWLPFYIFNVSSVSVAISPTPALKGMFDFVVILTYANSCANPILYAFLSDNFKKSFQNVLCLVKVSGAEDGERSDSKQDKSRLNETTETQRTLLNGDLQTSI |
| Organism_Source | Rattus norvegicus |
| Functional_Classification | G protein-coupled receptor |
| Cellular_Localization | Plasma membrane |
| Gene_Names | Sstr2 |
| UniProt_ID | P30680 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | 99mTc-EDDA/HYNIC-RC160 |
|---|---|
| Peptide_Sequence | fCYwKVCW |
| Peptide_Length | 8 |
| Peptide_SMILES | CC(C)[C@H](NC(=O)[C@H](CCCCN)NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](CS)NC(=O)[C@@H](N)Cc1ccccc1)C(=O)N[C@@H](CS)C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)O |
| Chemical_Modification | K5=hydrazinonicotinamide |
| Cyclization_Method | Side chain-side chain cyclization; C2<->C7; disulfide bond |
| Linear/Cyclic | Cyclic |
| N-terminal_Modification | Free |
| C-terminal_Modification | amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1134.38 |
|---|---|
| Aliphatic_Index | 36.25000 |
| Aromaticity | 0.50000 |
| Average_Rotatable_Bonds | 3.75000 |
| Charge_at_pH_7 | 0.87289 |
| Isoelectric_Point | 8.22117 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 13 |
| Number_of_Hydrogen_Bond_Donors | 15 |
| Topological_Polar_Surface_Area | 344.85000 |
| X_logP_energy | 2.07550 |
Interaction Information
| Affinity | KD=2.3 nM |
|---|---|
| Affinity_Assay | radioligand saturation assay |
| PDB_ID | None |
| Type | Agonist |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | The new millennium: applying novel technology to the study of the cancer cell in situ. |
| Release_Year | 1999 |
| PMID | 10744468 |
| DOI | 10.1007/s002590050511 |