PPIRE08309
Target Protein Information
| Protein_Name | Chromobox protein homolog 7 |
|---|---|
| Protein_Sequence | MELSAIGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEKEERDRASGYRKRGPKPKRLLLQRLYSMDLRSSHKAKGKEKLCFSLTCPLGSGSPEGVVKAGAPELVDKGPLVPTLPFPLRKPRKAHKYLRLSRKKFPPRGPNLESHSHRRELFLQEPPAPDVLQAAGEWEPAAQPPEEEADADLAEGPPPWTPALPSSEVTVTDITANSITVTFREAQAAEGFFRDRSGKF |
| Organism_Source | Homo sapiens |
| Functional_Classification | Polycomb group proteins |
| Cellular_Localization | Nucleus |
| Gene_Names | CBX7 |
| UniProt_ID | O95931 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | H3K9me3 peptide |
|---|---|
| Peptide_Sequence | ARTKQTARX |
| Peptide_Length | 9 |
| Peptide_SMILES | C[C@H](N)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@H](C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@H](C(=O)N[C@@H](C)C(=O)N[C@@H](CCCNC(=N)N)C(=O)NCC(=O)O)[C@@H](C)O)[C@@H](C)O |
| Chemical_Modification | X9=N,N,N-trimethyllysine |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 988.11 |
|---|---|
| Aliphatic_Index | 22.22222 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 3.77778 |
| Charge_at_pH_7 | 2.99768 |
| Isoelectric_Point | 12.51648 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 16 |
| Number_of_Hydrogen_Bond_Donors | 20 |
| Topological_Polar_Surface_Area | 529.49000 |
| X_logP_energy | -8.36946 |
Interaction Information
| Affinity | KD=16.5 uM |
|---|---|
| Affinity_Assay | fluorescence anisotropy |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Molecular interplay of the noncoding RNA ANRIL and methylated histone H3 lysine 27 by polycomb CBX7 in transcriptional silencing of INK4a. |
| Release_Year | 2010 |
| PMID | 20541999 |
| DOI | 10.1016/j.molcel.2010.03.021 |