PPIRE08380
Target Protein Information
| Protein_Name | Microtubule-associated protein 1 light chain 3 beta |
|---|---|
| Protein_Sequence | MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFGMKLSV |
| Organism_Source | Homo sapiens |
| Functional_Classification | ubiquitin-like modifiers |
| Cellular_Localization | Cytoplasm |
| Gene_Names | MAP1LC3B |
| UniProt_ID | Q9GZQ8 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | PLEKHM1-LIR-V636G |
|---|---|
| Peptide_Sequence | EDEWGNVQY |
| Peptide_Length | 9 |
| Peptide_SMILES | CC(C)[C@H](NC(=O)[C@H](CC(N)=O)NC(=O)CNC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CC(=O)O)NC(=O)[C@@H](N)CCC(=O)O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1139.14 |
|---|---|
| Aliphatic_Index | 32.22222 |
| Aromaticity | 0.22222 |
| Average_Rotatable_Bonds | 3.88889 |
| Charge_at_pH_7 | -2.99887 |
| Isoelectric_Point | 3.42471 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 16 |
| Number_of_Hydrogen_Bond_Donors | 17 |
| Topological_Polar_Surface_Area | 530.22000 |
| X_logP_energy | -4.41840 |
Interaction Information
| Affinity | KD=52 uM |
|---|---|
| Affinity_Assay | Isothermal titration calorimetry |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Structural and functional analysis of the GABARAP interaction motif (GIM). |
| Release_Year | 2017 |
| PMID | 28655748 |
| DOI | 10.15252/embr.201643587 |