PPIRE08413
Target Protein Information
| Protein_Name | H-2 class I histocompatibility antigen, K-Q alpha chain |
|---|---|
| Protein_Sequence | PRFISVGYVDDTELVRFDSDAENPRYEPRARWMEQVEPEYWERNTQIAKDNEQSSRVDLRTLLRYYNQSAGGSHTIQRMYGCDVGSDGRLLRGYEQVAYDGCDYIALNEDLKTWTAADMAALITKHKWEQAGAAERRRAYLEGACVEWLSRHLKNGNATLLRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQYYTCHVYHQGLPKPLTLRWEPPPSAVSNTVIIAVLVVLGAAIVTGAVVAFVMMRRRNTGGKGGDYALAPGSQTSDLSLPDCKVMVHDPHSLA |
| Organism_Source | Mus musculus |
| Functional_Classification | Major histocompatibility complex class I |
| Cellular_Localization | Plasma membrane |
| Gene_Names | H2-K1 |
| UniProt_ID | P14428 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | FAPKNYPAL |
|---|---|
| Peptide_Sequence | FAPKNYPAL |
| Peptide_Length | 9 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)[C@H](C)NC(=O)[C@@H]1CCCN1C(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@@H]1CCCN1C(=O)[C@H](C)NC(=O)[C@@H](N)Cc1ccccc1)C(=O)O |
| Chemical_Modification | |
| Cyclization_Method | |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1020.20 |
|---|---|
| Aliphatic_Index | 65.55556 |
| Aromaticity | 0.22222 |
| Average_Rotatable_Bonds | 3.00000 |
| Charge_at_pH_7 | 0.99684 |
| Isoelectric_Point | 9.29830 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 13 |
| Number_of_Hydrogen_Bond_Donors | 11 |
| Topological_Polar_Surface_Area | 367.88000 |
| X_logP_energy | -1.42960 |
Interaction Information
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | The first step of peptide selection in antigen presentation by MHC class I molecules. |
| Release_Year | 2014 |
| PMID | 25605945 |
| DOI | 10.1073/pnas.1416543112 |