PPIRE08458
Target Protein Information
| Protein_Name | Triosephosphate isomerase |
|---|---|
| Protein_Sequence | MARKYFVAANWKCNGTLESIKSLTNSFNNLDFDPSKLDVVVFPVSVHYDHTRKLLQSKFSTGIQNVSKFGNGSYTGEVSAEIAKDLNIEYVIIGHFERRKYFHETDEDVREKLQASLKNNLKAVVCFGESLEQREQNKTIEVITKQVKAFVDLIDNFDNVILAYEPLWAIGTGKTATPEQAQLVHKEIRKIVKDTCGEKQANQIRILYGGSVNTENCSSLIQQEDIDGFLVGNASLKESFVDIIKSAM |
| Organism_Source | Plasmodium falciparum |
| Functional_Classification | isomerases |
| Cellular_Localization | Cytoplasm |
| Gene_Names | TPI |
| UniProt_ID | Q07412 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Peptide II |
|---|---|
| Peptide_Sequence | KFGNGSYTGEVS |
| Peptide_Length | 12 |
| Peptide_SMILES | CC(C)[C@H](NC(=O)[C@H](CCC(=O)O)NC(=O)CNC(=O)[C@@H](NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](CO)NC(=O)CNC(=O)[C@H](CC(N)=O)NC(=O)CNC(=O)[C@H](Cc1ccccc1)NC(=O)[C@@H](N)CCCCN)[C@@H](C)O)C(=O)N[C@@H](CO)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Acetyl |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1245.31 |
|---|---|
| Aliphatic_Index | 24.16667 |
| Aromaticity | 0.16667 |
| Average_Rotatable_Bonds | 3.33333 |
| Charge_at_pH_7 | -0.00139 |
| Isoelectric_Point | 6.40200 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 20 |
| Number_of_Hydrogen_Bond_Donors | 20 |
| Topological_Polar_Surface_Area | 570.75000 |
| X_logP_energy | -8.29310 |
Interaction Information
| Affinity | IC50=0.6 mM |
|---|---|
| Affinity_Assay | Enzyme Inhibition Kinetics |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Synthetic peptides as inactivators of multimeric enzymes: inhibition of Plasmodium falciparum triosephosphate isomerase by interface peptides. |
| Release_Year | 2001 |
| PMID | 11457449 |
| DOI | 10.1016/S0014-5793(01)02606-0 |