PPIRE08491
Target Protein Information
| Protein_Name | L-selectin |
|---|---|
| Protein_Sequence | MIFPWKCQSTQRDLWNIFKLWGWTMLCCDFLAHHGTDCWTYHYSEKPMNWQRARRFCRDNYTDLVAIQNKAEIEYLEKTLPFSRSYYWIGIRKIGGIWTWVGTNKSLTEEAENWGDGEPNNKKNKEDCVEIYIKRNKDAGKWNDDACHKLKAALCYTASCQPWSCSGHGECVEIINNYTCNCDVGYYGPQCQFVIQCEPLEAPELGTMDCTHPLGNFSFSSQCAFSCSEGTNLTGIEETTCGPFGNWSSPEPTCQVIQCEPLSAPDLGIMNCSHPLASFSFTSACTFICSEGTELIGKKKTICESSGIWSNPSPICQKLDKSFSMIKEGDYNPLFIPVAVMVTAFSGLAFIIWLARRLKKGKKSKRSMNDPY |
| Organism_Source | Homo sapiens |
| Functional_Classification | selectins |
| Cellular_Localization | Plasma membrane |
| Gene_Names | SELL |
| UniProt_ID | P14151 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Antiflammin-2 |
|---|---|
| Peptide_Sequence | HDMNKVLDL |
| Peptide_Length | 9 |
| Peptide_SMILES | CSCC[C@H](NC(=O)[C@H](CC(=O)O)NC(=O)[C@@H](N)Cc1c[nH]cn1)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CC(C)C)C(=O)O)C(C)C |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1084.26 |
|---|---|
| Aliphatic_Index | 118.88889 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 4.11111 |
| Charge_at_pH_7 | -0.91051 |
| Isoelectric_Point | 5.40813 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 16 |
| Number_of_Hydrogen_Bond_Donors | 15 |
| Topological_Polar_Surface_Area | 468.51000 |
| X_logP_energy | -3.30240 |
Interaction Information
| Affinity | IC50=18 mM |
|---|---|
| Affinity_Assay | flow cytometry |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Rational optimization of a short human P-selectin-binding peptide leads to nanomolar affinity antagonists. |
| Release_Year | 2000 |
| PMID | None |
| DOI | 10.1096/fj.99-0296fje |