PPIRE08529
Target Protein Information
| Protein_Name | Speckle-type POZ protein |
|---|---|
| Protein_Sequence | MSRVPSPPPPAEMSSGPVAESWCYTQIKVVKFSYMWTINNFSFCREEMGEVIKSSTFSSGANDKLKWCLRVNPKGLDEESKDYLSLYLLLVSCPKSEVRAKFKFSILNAKGEETKAMESQRAYRFVQGKDWGFKKFIRRDFLLDEANGLLPDDKLTLFCEVSVVQDSVNISGQNTMNMVKVPECRLADELGGLWENSRFTDCCLCVAGQEFQAHKAILAARSPVFSAMFEHEMEESKKNRVEINDVEPEVFKEMMCFIYTGKAPNLDKMADDLLAAADKYALERLKVMCEDALCSNLSVENAAEILILADLHSADQLKTQAVDFINYHASDVLETSGWKSMVVSHPHLVAEAYRSLASAQCPFLGPPRKRLKQS |
| Organism_Source | Homo sapiens |
| Functional_Classification | E3 ubiquitin-protein ligase |
| Cellular_Localization | Nucleus |
| Gene_Names | SPOP |
| UniProt_ID | O43791 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | BRD3(residues 245-253) |
|---|---|
| Peptide_Sequence | KADTTTPTT |
| Peptide_Length | 9 |
| Peptide_SMILES | C[C@H](NC(=O)[C@@H](N)CCCCN)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@H](C(=O)N1CCC[C@H]1C(=O)N[C@H](C(=O)N[C@H](C(=O)O)[C@@H](C)O)[C@@H](C)O)[C@@H](C)O)[C@@H](C)O)[C@@H](C)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 935.00 |
|---|---|
| Aliphatic_Index | 11.11111 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 3.00000 |
| Charge_at_pH_7 | -0.00186 |
| Isoelectric_Point | 6.33737 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 17 |
| Number_of_Hydrogen_Bond_Donors | 16 |
| Topological_Polar_Surface_Area | 451.80000 |
| X_logP_energy | -7.68950 |
Interaction Information
| Affinity | KD=168 uM |
|---|---|
| Affinity_Assay | Isothermal titration calorimetry |
| PDB_ID | 6I41 |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Structural Insights into BET Client Recognition of Endometrial and Prostate Cancer-Associated SPOP Mutants. |
| Release_Year | 2019 |
| PMID | 31026449 |
| DOI | 10.1016/j.jmb.2019.04.017 |