PPIRE08540
Target Protein Information
| Protein_Name | Trypsin |
|---|---|
| Protein_Sequence | FPTDDDDKIVGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYKSRIQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSRVATVSLPRSCAAAGTECLISGWGNTKSSGSSYPSLLQCLKAPVLSDSSCKSSYPGQITGNMICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCAQKNKPGVYTKVCNYVNWIQQTIAAN |
| Organism_Source | Sus scrofa |
| Functional_Classification | serine endopeptidases |
| Cellular_Localization | Extracellular |
| Gene_Names | None |
| UniProt_ID | P00761 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | pompanopeptin A |
|---|---|
| Peptide_Sequence | VXIXRTXX |
| Peptide_Length | 8 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)CNC(=O)[C@@H](N)C(C)C)C(=O)NCC(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@H](C(=O)NCC(=O)NCC(=O)O)[C@@H](C)O |
| Chemical_Modification | X2=N,O-dimethyl-3-bromotyrosine; X4=3-amino-6-hydroxy-2-piperidone; X7=methionine sulfoxide; X8=butanoic acid |
| Cyclization_Method | main chain-main chain cyclization; T6<->V1; other bonds |
| Linear/Cyclic | Cyclic |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 715.81 |
|---|---|
| Aliphatic_Index | 85.00000 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 2.87500 |
| Charge_at_pH_7 | 0.99798 |
| Isoelectric_Point | 10.55000 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 11 |
| Number_of_Hydrogen_Bond_Donors | 13 |
| Topological_Polar_Surface_Area | 349.15000 |
| X_logP_energy | -5.33633 |
Interaction Information
| Affinity | IC50=2.4 mM |
|---|---|
| Affinity_Assay | Enzyme Inhibition Kinetics |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | DNA binding discrimination of the murine DNA cytosine-C5 methyltransferase. |
| Release_Year | 2008 |
| PMID | None |
| DOI | 10.1016/j.tet.2008.02.035 |