PPIRE08586
Target Protein Information
| Protein_Name | L-selectin |
|---|---|
| Protein_Sequence | MIFPWKCQSTQRDLWNIFKLWGWTMLCCDFLAHHGTDCWTYHYSEKPMNWQRARRFCRDNYTDLVAIQNKAEIEYLEKTLPFSRSYYWIGIRKIGGIWTWVGTNKSLTEEAENWGDGEPNNKKNKEDCVEIYIKRNKDAGKWNDDACHKLKAALCYTASCQPWSCSGHGECVEIINNYTCNCDVGYYGPQCQFVIQCEPLEAPELGTMDCTHPLGNFSFSSQCAFSCSEGTNLTGIEETTCGPFGNWSSPEPTCQVIQCEPLSAPDLGIMNCSHPLASFSFTSACTFICSEGTELIGKKKTICESSGIWSNPSPICQKLDKSFSMIKEGDYNPLFIPVAVMVTAFSGLAFIIWLARRLKKGKKSKRSMNDPY |
| Organism_Source | Homo sapiens |
| Functional_Classification | selectins |
| Cellular_Localization | Plasma membrane |
| Gene_Names | SELL |
| UniProt_ID | P14151 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Antiflammin-1 |
|---|---|
| Peptide_Sequence | MQMKKVLDS |
| Peptide_Length | 9 |
| Peptide_SMILES | CSCC[C@H](NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](N)CCSC)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CO)C(=O)O)C(C)C |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1079.34 |
|---|---|
| Aliphatic_Index | 75.55556 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 4.44444 |
| Charge_at_pH_7 | 0.99784 |
| Isoelectric_Point | 9.53730 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 17 |
| Number_of_Hydrogen_Bond_Donors | 15 |
| Topological_Polar_Surface_Area | 448.78000 |
| X_logP_energy | -3.52450 |
Interaction Information
| Affinity | IC50=6.3 mM |
|---|---|
| Affinity_Assay | flow cytometry |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Peptides targeting the PDZ domain of PTPN4 are efficient inducers of glioblastoma cell death. |
| Release_Year | 2000 |
| PMID | None |
| DOI | 10.1096/fj.99-0296fje |