PPIRE08669
Target Protein Information
| Protein_Name | Protein AF-9 homolog |
|---|---|
| Protein_Sequence | MAPTISKRIKTLSVSRPIIYGNTAKKMGSVKPPNAPAEHTHLWTIFVRGPQNEDISYFIKKVVFKLHDTYPNPVRSIEAPPFELTETGWGEFDINIKVYFVEEANEKVLNFYHRLRLHPYANPVPNSDNGNEQNTTDHNSKDAEVSSVYFDEIVFNEPNEEFFKILMSRPGNLLPSNKTDDCVYSKQLEQEEIDRIEIGIEKVDKEIDELKQKLENLVKQEAINGS |
| Organism_Source | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) |
| Functional_Classification | histone acetylation reader |
| Cellular_Localization | Nucleus |
| Gene_Names | YAF9 |
| UniProt_ID | P53930 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | H3K9ac peptide |
|---|---|
| Peptide_Sequence | QTARKSTGG |
| Peptide_Length | 9 |
| Peptide_SMILES | C[C@H](NC(=O)[C@@H](NC(=O)[C@@H](N)CCC(N)=O)[C@@H](C)O)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CO)C(=O)N[C@H](C(=O)NCC(=O)NCC(=O)O)[C@@H](C)O |
| Chemical_Modification | K5=acetyllysine |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 904.98 |
|---|---|
| Aliphatic_Index | 11.11111 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 3.44444 |
| Charge_at_pH_7 | 1.99769 |
| Isoelectric_Point | 11.65178 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 16 |
| Number_of_Hydrogen_Bond_Donors | 18 |
| Topological_Polar_Surface_Area | 487.82000 |
| X_logP_energy | -9.02893 |
Interaction Information
| Affinity | KD=39 uM |
|---|---|
| Affinity_Assay | intrinsic tryptophan fluorescence |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Yaf9 subunit of the NuA4 and SWR1 complexes targets histone H3K27ac through its YEATS domain. |
| Release_Year | 2018 |
| PMID | 29145630 |
| DOI | 10.1093/nar/gkx1151 |