PPIRE08823
Target Protein Information
| Protein_Name | H-2 class I histocompatibility antigen, K-Q alpha chain |
|---|---|
| Protein_Sequence | PRFISVGYVDDTELVRFDSDAENPRYEPRARWMEQVEPEYWERNTQIAKDNEQSSRVDLRTLLRYYNQSAGGSHTIQRMYGCDVGSDGRLLRGYEQVAYDGCDYIALNEDLKTWTAADMAALITKHKWEQAGAAERRRAYLEGACVEWLSRHLKNGNATLLRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQYYTCHVYHQGLPKPLTLRWEPPPSAVSNTVIIAVLVVLGAAIVTGAVVAFVMMRRRNTGGKGGDYALAPGSQTSDLSLPDCKVMVHDPHSLA |
| Organism_Source | Mus musculus |
| Functional_Classification | MHC class I |
| Cellular_Localization | Plasma membrane |
| Gene_Names | H2-K1 |
| UniProt_ID | P14428 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | YEA9 |
|---|---|
| Peptide_Sequence | SRDHSRTPM |
| Peptide_Length | 9 |
| Peptide_SMILES | CSCC[C@H](NC(=O)[C@@H]1CCCN1C(=O)[C@@H](NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CO)NC(=O)[C@H](Cc1c[nH]cn1)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@@H](N)CO)[C@@H](C)O)C(=O)O |
| Chemical_Modification | |
| Cyclization_Method | |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1086.19 |
|---|---|
| Aliphatic_Index | 0.00000 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 3.77778 |
| Charge_at_pH_7 | 1.08933 |
| Isoelectric_Point | 10.39953 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 18 |
| Number_of_Hydrogen_Bond_Donors | 20 |
| Topological_Polar_Surface_Area | 537.80000 |
| X_logP_energy | -8.13156 |
Interaction Information
| Affinity | KD=730 nM |
|---|---|
| Affinity_Assay | radioligand competition binding assay |
| PDB_ID | 1G7P |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Crystal structure of a non-canonical high affinity peptide complexed with MHC class I: a novel use of alternative anchors. |
| Release_Year | 2002 |
| PMID | 12083519 |
| DOI | 10.1016/S0022-2836(02)00198-5 |