PPIRE09108
Target Protein Information
| Protein_Name | Cathepsin E |
|---|---|
| Protein_Sequence | MKTLLLLLLVLLELGEAQGSLHRVPLRRHPSLKKKLRARSQLSEFWKSHNLDMIQFTESCSMDQSAKEPLINYLDMEYFGTISIGSPPQNFTVIFDTGSSNLWVPSVYCTSPACKTHSRFQPSQSSTYSQPGQSFSIQYGTGSLSGIIGADQVSVEGLTVVGQQFGESVTEPGQTFVDAEFDGILGLGYPSLAVGGVTPVFDNMMAQNLVDLPMFSVYMSSNPEGGAGSELIFGGYDHSHFSGSLNWVPVTKQAYWQIALDNIQVGGTVMFCSEGCQAIVDTGTSLITGPSDKIKQLQNAIGAAPVDGEYAVECANLNVMPDVTFTINGVPYTLSPTAYTLLDFVDGMQFCSSGFQGLDIHPPAGPLWILGDVFIRQFYSVFDRGNNRVGLAPAVP |
| Organism_Source | Homo sapiens |
| Functional_Classification | proteases |
| Cellular_Localization | Lysosome |
| Gene_Names | CTSE |
| UniProt_ID | P14091 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | symplocin A |
|---|---|
| Peptide_Sequence | XXYSXVGXP |
| Peptide_Length | 9 |
| Peptide_SMILES | CC(C)[C@H](NC(=O)CNC(=O)[C@H](CO)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)CNC(=O)CN)C(=O)NCC(=O)NCC(=O)N1CCC[C@H]1C(=O)O |
| Chemical_Modification | X1=N,N-dimethylisoleucine; X2=2-hydroxy-3-methylbutanoyl (valic acid); X5=4-amino-3-hydroxy-6-methylheptanoic acid (statine); X8=N-methylphenylalanine |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | N,N-Dimethyl |
| C-terminal_Modification | methyl ester |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 749.78 |
|---|---|
| Aliphatic_Index | 32.22222 |
| Aromaticity | 0.11111 |
| Average_Rotatable_Bonds | 2.22222 |
| Charge_at_pH_7 | -0.00287 |
| Isoelectric_Point | 6.09320 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 12 |
| Number_of_Hydrogen_Bond_Donors | 11 |
| Topological_Polar_Surface_Area | 327.79000 |
| X_logP_energy | -5.46350 |
Interaction Information
| Affinity | IC50=300 pM |
|---|---|
| Affinity_Assay | Enzyme Inhibition Kinetics |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Symplocin A, a linear peptide from the Bahamian cyanobacterium Symploca sp. Configurational analysis of N,N-dimethylamino acids by chiral-phase HPLC of naphthacyl esters. |
| Release_Year | 2012 |
| PMID | 22360587 |
| DOI | 10.1021/np200861n |