PPIRE09216
Target Protein Information
| Protein_Name | HLA class I histocompatibility antigen, A alpha chain |
|---|---|
| Protein_Sequence | MAVMAPRTLLLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGTLRGYYNQSEAGSHTIQIMYGCDVGSDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAAHEAEQLRAYLDGTCVEWLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWELSSQPTIPIVGIIAGLVLLGAVITGAVVAAVMWRRKSSDRKGGSYTQAASSDSAQGSDVSLTACKV |
| Organism_Source | Homo sapiens |
| Functional_Classification | MHC class I |
| Cellular_Localization | Plasma membrane |
| Gene_Names | HLA-A |
| UniProt_ID | P04439 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | AQASIELPSM |
|---|---|
| Peptide_Sequence | AQASIELPSM |
| Peptide_Length | 10 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](CO)NC(=O)[C@H](C)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](C)N)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CC(C)C)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CO)C(=O)N[C@@H](CCSC)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1046.20 |
|---|---|
| Aliphatic_Index | 98.00000 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 3.30000 |
| Charge_at_pH_7 | -1.00024 |
| Isoelectric_Point | 3.84998 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 16 |
| Number_of_Hydrogen_Bond_Donors | 14 |
| Topological_Polar_Surface_Area | 437.28000 |
| X_logP_energy | -4.73230 |
Interaction Information
| Affinity | IC50=1060 nM |
|---|---|
| Affinity_Assay | competitive radioligand binding assay |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Phosphorylation-dependent interaction between antigenic peptides and MHC class I: a molecular basis for the presentation of transformed self. |
| Release_Year | 2008 |
| PMID | 18836451 |
| DOI | 10.1038/ni.1660 |