PPIRE09531
Target Protein Information
| Protein_Name | Alpha-synuclein |
|---|---|
| Protein_Sequence | MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA |
| Organism_Source | Homo sapiens |
| Functional_Classification | presynaptic proteins |
| Cellular_Localization | Cytoplasm |
| Gene_Names | SNCA |
| UniProt_ID | P37840 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Ac-alpha-syn(1-10) |
|---|---|
| Peptide_Sequence | MDVFMKGLSK |
| Peptide_Length | 10 |
| Peptide_SMILES | CSCC[C@H](NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@@H](NC(=O)[C@H](CC(=O)O)NC(=O)[C@@H](N)CCSC)C(C)C)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCCN)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Acetyl |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1155.44 |
|---|---|
| Aliphatic_Index | 68.00000 |
| Aromaticity | 0.10000 |
| Average_Rotatable_Bonds | 4.10000 |
| Charge_at_pH_7 | 0.99784 |
| Isoelectric_Point | 9.53730 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 17 |
| Number_of_Hydrogen_Bond_Donors | 15 |
| Topological_Polar_Surface_Area | 434.79000 |
| X_logP_energy | -2.43110 |
Interaction Information
| Affinity | KD=100 nM |
|---|---|
| Affinity_Assay | Isothermal titration calorimetry |
| PDB_ID | 6CT7 |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Development of an aggregate-selective, human-derived Alpha-synuclein antibody BIIB054 that ameliorates disease phenotypes in Parkinson's disease models. |
| Release_Year | 2018 |
| PMID | 30381260 |
| DOI | 10.1016/j.nbd.2018.10.016 |