PPIRE09534
Target Protein Information
| Protein_Name | None |
|---|---|
| Protein_Sequence | MAPPVTERGLKSVVWRKIKTTVFDDCRKEGEWKIMLLDDFTTRLLSSCCKMTDLLEEGVTVIENIYKNREPVRQMKALYFISPTPKVPMEARRGYWIPGNW |
| Organism_Source | Rattus norvegicus |
| Functional_Classification | Sec1/Munc18 family |
| Cellular_Localization | Cytoplasm |
| Gene_Names | Stxbp3 |
| UniProt_ID | A0A8I5Y973 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Sx1 N-peptide |
|---|---|
| Peptide_Sequence | MKDRTQELRT |
| Peptide_Length | 10 |
| Peptide_SMILES | CSCC[C@H](N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@H](C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@H](C(=O)O)[C@@H](C)O)[C@@H](C)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1277.46 |
|---|---|
| Aliphatic_Index | 39.00000 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 4.60000 |
| Charge_at_pH_7 | 0.99990 |
| Isoelectric_Point | 9.69016 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 20 |
| Number_of_Hydrogen_Bond_Donors | 23 |
| Topological_Polar_Surface_Area | 633.19000 |
| X_logP_energy | -7.41716 |
Interaction Information
| Affinity | KD=18 uM |
|---|---|
| Affinity_Assay | Isothermal titration calorimetry |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Possible roles for Munc18-1 domain 3a and Syntaxin1 N-peptide and C-terminal anchor in SNARE complex formation. |
| Release_Year | 2011 |
| PMID | 21193638 |
| DOI | 10.1073/pnas.0914906108 |