PPIRE09584
Target Protein Information
| Protein_Name | Renin receptor |
|---|---|
| Protein_Sequence | MAVFVVLLALVAGVLGNEFSILKSPGSVVFRNGNWPIPGERIPDVAALSMGFSVKEDLSWPGLAVGNLFHRPRATVMVMVKGVNKLALPPGSVISYPLENAVPFSLDSVANSIHSLFSEETPVVLQLAPSEERVYMVGKANSVFEDLSVTLRQLRNRLFQENSVLSSLPLNSLSRNNEVDLLFLSELQVLHDISSLLSRHKHLAKDHSPDLYSLELAGLDEIGKRYGEDSEQFRDASKILVDALQKFADDMYSLYGGNAVVELVTVKSFDTSLIRKTRTILEAKQAKNPASPYNLAYKYNFEYSVVFNMVLWIMIALALAVIITSYNIWNMDPGYDSIIYRMTNQKIRMD |
| Organism_Source | Homo sapiens |
| Functional_Classification | single-pass transmembrane receptor |
| Cellular_Localization | Plasma membrane |
| Gene_Names | ATP6AP2 |
| UniProt_ID | O75787 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Decoy peptide |
|---|---|
| Peptide_Sequence | RIFLKRMPSI |
| Peptide_Length | 10 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](CO)NC(=O)[C@@H]1CCCN1C(=O)[C@H](CCSC)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@@H](NC(=O)[C@@H](N)CCCNC(=N)N)[C@@H](C)CC)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1260.61 |
|---|---|
| Aliphatic_Index | 117.00000 |
| Aromaticity | 0.10000 |
| Average_Rotatable_Bonds | 4.20000 |
| Charge_at_pH_7 | 2.99768 |
| Isoelectric_Point | 12.51648 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 16 |
| Number_of_Hydrogen_Bond_Donors | 18 |
| Topological_Polar_Surface_Area | 486.48000 |
| X_logP_energy | -1.95036 |
Interaction Information
| Affinity | KD=3.5 nM |
|---|---|
| Affinity_Assay | Surface plasmon resonance |
| PDB_ID | None |
| Type | antagonist |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Decoy peptide' region (RIFLKRMPSI)of prorenin prosegment plays a crucial role in prorenin binding to the (pro)renin receptor. |
| Release_Year | 2009 |
| PMID | 19513539 |
| DOI | 10.3892/ijmm_00000210 |